(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE490

CP002209.PE490       Location/Qualifiers
FT   CDS             complement(539550..540101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP1297 hypothetical protein; SPTR: A0XZN4
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74704"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP0"
FT                   /protein_id="ADN74704.1"
FT                   /translation="MSTHWLITDIWGQHATLDPFLRRLEAIAPDWQVLDPYSGQRFAFE
FT                   DETQAYQYFLHRCSKATYQQKLEAVLEQAQQPLTLLACSAGANALWPLLDGPLASKIRK
FT                   AVLVYGSTIPEQPITPRCDTALLLCRGDNGVTGHQERLAQHSTLLLSDAPHGFLNPRAP
FT                   GYHPDAAAEAEAWLQQQLTR"
     MSTHWLITDI WGQHATLDPF LRRLEAIAPD WQVLDPYSGQ RFAFEDETQA YQYFLHRCSK        60
     ATYQQKLEAV LEQAQQPLTL LACSAGANAL WPLLDGPLAS KIRKAVLVYG STIPEQPITP       120
     RCDTALLLCR GDNGVTGHQE RLAQHSTLLL SDAPHGFLNP RAPGYHPDAA AEAEAWLQQQ       180
     LTR                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page