(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE496

CP002209.PE496       Location/Qualifiers
FT   CDS             544458..545396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0496"
FT                   /product="periplasmic solute binding protein"
FT                   /note="COGs: COG0803 ABC-type metal ion transport system
FT                   periplasmic component/surface adhesin; InterPro IPR006127:
FT                   IPR018115; KEGG: sse:Ssed_0617 periplasmic solute binding
FT                   protein; PFAM: periplasmic solute binding protein; SPTR:
FT                   A2UUS9 Periplasmic solute binding protein; PFAM:
FT                   Periplasmic solute binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74710"
FT                   /db_xref="GOA:E1SPP6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP6"
FT                   /protein_id="ADN74710.1"
FT                   /translation="MHINSDINRGLSRQLPWLLLAALVMLWAPRSWALSVFACEPEYAS
FT                   LARELAPEADIFSATTALQDPHQVQARPSLIAKMRRADLAVCAGAELEVGWLPMLQMKA
FT                   NNPRIRNGQPGMFYAADQVETLDKMDNVDRTMGDVHAQGNPHMQFSPERVTAIATALAK
FT                   RMAELDPDNGTRYQANLADFLGRWQAAVPQWQAKAQPLEGHKVIAYHTSFRYLFDWVGI
FT                   SQVGDLEPKPGLPPTTSHLATLLKRAEQGDVMAVVYTGYQDSRGAQWLAQRADLPLVEL
FT                   PFGPGVDGIADLFDLYDHAIDALVAAQREPR"
     MHINSDINRG LSRQLPWLLL AALVMLWAPR SWALSVFACE PEYASLAREL APEADIFSAT        60
     TALQDPHQVQ ARPSLIAKMR RADLAVCAGA ELEVGWLPML QMKANNPRIR NGQPGMFYAA       120
     DQVETLDKMD NVDRTMGDVH AQGNPHMQFS PERVTAIATA LAKRMAELDP DNGTRYQANL       180
     ADFLGRWQAA VPQWQAKAQP LEGHKVIAYH TSFRYLFDWV GISQVGDLEP KPGLPPTTSH       240
     LATLLKRAEQ GDVMAVVYTG YQDSRGAQWL AQRADLPLVE LPFGPGVDGI ADLFDLYDHA       300
     IDALVAAQRE PR                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page