(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE52

CP002209.PE52        Location/Qualifiers
FT   CDS             complement(67531..67854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0052"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: shm:Shewmr7_0441 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74266"
FT                   /db_xref="GOA:E1SVB2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB2"
FT                   /protein_id="ADN74266.1"
FT                   /translation="MKTTSQTALAMLLLTLAAGAMAVDGGNPKKGKHEYKRECKACHTV
FT                   GAEGGEITPMSKTMGQWDRFFQRDKHKAKPEVFEQLDPQKLLNIHQFLYDHAADSEQPA
FT                   TCG"
     MKTTSQTALA MLLLTLAAGA MAVDGGNPKK GKHEYKRECK ACHTVGAEGG EITPMSKTMG        60
     QWDRFFQRDK HKAKPEVFEQ LDPQKLLNIH QFLYDHAADS EQPATCG                     107
//

If you have problems or comments...

PBIL Back to PBIL home page