(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE53

CP002209.PE53        Location/Qualifiers
FT   CDS             68399..70399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0053"
FT                   /product="Protein of unknown function DUF1800"
FT                   /note="COGs: COG5267 conserved hypothetical protein;
FT                   InterPro IPR014917; KEGG: vpa:VPA0969 hypothetical protein;
FT                   PFAM: Protein of unknown function DUF1800; SPTR: A0XXJ2
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1800)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74267"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB3"
FT                   /protein_id="ADN74267.1"
FT                   /translation="MGLNLKPILLCQALCALVLLQGCGDTEPQIPESPGIDEKEPTPDP
FT                   TPDPTPDPDPTPDPDPTPDPDPTPDPDPDPDPDPDPDPTPDPDPTPEPEQNQAPLAMDY
FT                   VHPDTVRYGASVTLSLDQLGQDADGDALQLAQWVTDDDSTAISVNEQGELTLRPLKTGT
FT                   QQWAFQLSDGEAESEMATFTVTVDAPSKKQYQRLLLQSTFGPTPADVENYAGFEPVAWI
FT                   DEQLALSPSSHEPAELMGISHDDREDTWFYLSATAPDQLRQRVAFALSELFVVSRLGVL
FT                   SQREEALTRYYNNLVTGSFGNYRDLLEAVSLHPAMGAYLTLINSRKADEARGFQPDENY
FT                   AREVMQLFTIGLYELNADGTLKRDDSGLPIPSYTQQDVQEIARAFTGWQKSDAEYIEPM
FT                   SADESYHDTGSKAALGHSLPAGQTALEDMRQVLDILFEHHNTPPFFARHMIQRLVSSNP
FT                   SPEYVERVAQVFIDNGHGVRGDIGAVVKALLLDEEALGLNPDAPPRKIKEPLIALLNLV
FT                   RGMNGQLDDQTRKFSGSKYAYWAAGQGPLRATSVFNFFSPDYVIGSEQKTAPEAEILSW
FT                   TAYAGCANYMRAMLFESKDVDFEVSYFTEDFDDVDRAIDKIRFLFFGEDMNPTLEPHLR
FT                   ALIESASNPDVGMRETVGVLIANSDEFFIQD"
     MGLNLKPILL CQALCALVLL QGCGDTEPQI PESPGIDEKE PTPDPTPDPT PDPDPTPDPD        60
     PTPDPDPTPD PDPDPDPDPD PDPTPDPDPT PEPEQNQAPL AMDYVHPDTV RYGASVTLSL       120
     DQLGQDADGD ALQLAQWVTD DDSTAISVNE QGELTLRPLK TGTQQWAFQL SDGEAESEMA       180
     TFTVTVDAPS KKQYQRLLLQ STFGPTPADV ENYAGFEPVA WIDEQLALSP SSHEPAELMG       240
     ISHDDREDTW FYLSATAPDQ LRQRVAFALS ELFVVSRLGV LSQREEALTR YYNNLVTGSF       300
     GNYRDLLEAV SLHPAMGAYL TLINSRKADE ARGFQPDENY AREVMQLFTI GLYELNADGT       360
     LKRDDSGLPI PSYTQQDVQE IARAFTGWQK SDAEYIEPMS ADESYHDTGS KAALGHSLPA       420
     GQTALEDMRQ VLDILFEHHN TPPFFARHMI QRLVSSNPSP EYVERVAQVF IDNGHGVRGD       480
     IGAVVKALLL DEEALGLNPD APPRKIKEPL IALLNLVRGM NGQLDDQTRK FSGSKYAYWA       540
     AGQGPLRATS VFNFFSPDYV IGSEQKTAPE AEILSWTAYA GCANYMRAML FESKDVDFEV       600
     SYFTEDFDDV DRAIDKIRFL FFGEDMNPTL EPHLRALIES ASNPDVGMRE TVGVLIANSD       660
     EFFIQD                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page