(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE61

CP002209.PE61        Location/Qualifiers
FT   CDS             79911..80687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0061"
FT                   /product="protein of unknown function DUF548"
FT                   /note="InterPro IPR007536; KEGG: spc:Sputcn32_0100
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF548; SPTR: A1RQ25 UPF0341 protein Sputw3181_3966; PFAM:
FT                   Protein of unknown function (DUF548)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74275"
FT                   /db_xref="GOA:E1SVC1"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC1"
FT                   /protein_id="ADN74275.1"
FT                   /translation="MSTTIYLDPGSEQPARLAELAQRWQLHHCEDAPFRLTLEQDRLRL
FT                   YDRHQPKLGAIEVDLVGGAVAHRRKFGGGRGQAIAKAVGLKGGASPSVVDGTAGLGRDA
FT                   FVLASLGCDVTLVERHPVVAALLDDGLRRAYDDAEIGPWVSERMRLFHGNSLEALAELD
FT                   LQPDVVFLDPMYPHRAKSAQVKKEMRVFQELVGADMDADGLLAPALQLAQKRVVVKRPD
FT                   YAEPLADRAPTMVIDTKKNRFDVYVKAAMAELASER"
     MSTTIYLDPG SEQPARLAEL AQRWQLHHCE DAPFRLTLEQ DRLRLYDRHQ PKLGAIEVDL        60
     VGGAVAHRRK FGGGRGQAIA KAVGLKGGAS PSVVDGTAGL GRDAFVLASL GCDVTLVERH       120
     PVVAALLDDG LRRAYDDAEI GPWVSERMRL FHGNSLEALA ELDLQPDVVF LDPMYPHRAK       180
     SAQVKKEMRV FQELVGADMD ADGLLAPALQ LAQKRVVVKR PDYAEPLADR APTMVIDTKK       240
     NRFDVYVKAA MAELASER                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page