(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE65

CP002209.PE65        Location/Qualifiers
FT   CDS             83422..84198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0065"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: she:Shewmr4_0298 TetR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   TetR; SPTR: A2UXH6 Transcriptional regulator, TetR family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74279"
FT                   /db_xref="GOA:E1SVC5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC5"
FT                   /protein_id="ADN74279.1"
FT                   /translation="MQCPSTEAQFERSQLILNATEWLIETQGLIAFKISDLSNHAGIAN
FT                   SSLYKLFESKEDLLVCCFLRNATSNHFAPFEAQYPDLTPIQRVLIPIMFTFEATHFAPT
FT                   FNLVRQVAVNPMVWRRASPEKVKAFETRINLFWRAIKGYVVEAVESGDLVATEEEVLEL
FT                   TQAITFYLSGALSAYQSQLINNTYLKEKRYTLFRQLQKVFLPYQWRQQMELADFERIGM
FT                   RVHLYYRQLGETFNRCERCQQAGQCGAGTSPSVATE"
     MQCPSTEAQF ERSQLILNAT EWLIETQGLI AFKISDLSNH AGIANSSLYK LFESKEDLLV        60
     CCFLRNATSN HFAPFEAQYP DLTPIQRVLI PIMFTFEATH FAPTFNLVRQ VAVNPMVWRR       120
     ASPEKVKAFE TRINLFWRAI KGYVVEAVES GDLVATEEEV LELTQAITFY LSGALSAYQS       180
     QLINNTYLKE KRYTLFRQLQ KVFLPYQWRQ QMELADFERI GMRVHLYYRQ LGETFNRCER       240
     CQQAGQCGAG TSPSVATE                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page