(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE66

CP002209.PE66        Location/Qualifiers
FT   CDS             complement(84202..84945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0066"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="InterPro IPR013096; KEGG: sse:Ssed_4188 cupin 2
FT                   domain-containing protein; PFAM: Cupin 2 conserved barrel
FT                   domain protein; SPTR: A2UXI1 Putative uncharacterized
FT                   protein; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74280"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC6"
FT                   /protein_id="ADN74280.1"
FT                   /translation="MMKPVALILTALLAGNAYAGHGEHAFKMEQRPYQQPTAIPYDYSP
FT                   YSPQTTMPEQCRDPLVEQYIADWEAGKIDFNTITANDSIAKDQRFCKGLDNDGNILEVK
FT                   GCDLNNAPVGYLWKELADYPLTIGITNGGKSDHEPHFHGQPECYYAVSGRARTLADGEY
FT                   KWMEKGMYFYIPGNTIHNTPITEEEGFGVLYWYPKNAHFDGFKYYWRKDVKNLRVAEEA
FT                   FDRVDIMRKAAMGLGPYGTNEARFK"
     MMKPVALILT ALLAGNAYAG HGEHAFKMEQ RPYQQPTAIP YDYSPYSPQT TMPEQCRDPL        60
     VEQYIADWEA GKIDFNTITA NDSIAKDQRF CKGLDNDGNI LEVKGCDLNN APVGYLWKEL       120
     ADYPLTIGIT NGGKSDHEPH FHGQPECYYA VSGRARTLAD GEYKWMEKGM YFYIPGNTIH       180
     NTPITEEEGF GVLYWYPKNA HFDGFKYYWR KDVKNLRVAE EAFDRVDIMR KAAMGLGPYG       240
     TNEARFK                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page