(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE69

CP002209.PE69        Location/Qualifiers
FT   CDS             87208..88662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0069"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="COGs: COG0790 FOG: TPR repeat SEL1 subfamily;
FT                   InterPro IPR006597; KEGG: slo:Shew_3592 Sel1
FT                   domain-containing protein; PFAM: Sel1 domain protein
FT                   repeat-containing protein; SMART: Sel1 domain protein
FT                   repeat-containing protein; SPTR: A2V3P3 Sel1-like repeat;
FT                   PFAM: Sel1 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74283"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC9"
FT                   /protein_id="ADN74283.1"
FT                   /translation="MNDLELVRRLDRRLVDDYRLARNYCLDVPTFALVHLRSIAHRLTT
FT                   WLGERAELEFHSKNLYDRIEQLARAKVIDMRLARKLHKLRGDGNKGAHPEKYHLSLEQL
FT                   VQLAGKSVKDTARLCAEVFPLLHPDEAVPEWQFEPVDVVAGRELCYRAVMEDDPEAQYL
FT                   VGLSLKARSLMQQERARSYALANDGQIPDLSDARRVLEQAAYWFRRAAQEHPAARFEHG
FT                   VALLNGYGGERDPQAAVRLIAEAAEQGVADALALVGYFYLAGSQGYGQDPLKAEHYLKL
FT                   AAEQDQPEAMANLGVLYYQGLLGQPDLAQARACSEQAALAGYPHAQYHLAVMLFAGEGG
FT                   DADPEAGLSWLRQAAAQHYPDALADLAQRTLDGDGVDTNPAAAVTLYQEAIQYGRLPRA
FT                   MFELALAHFDGEVPERDLATAGQLLHQAFLHAVPDSELAEAIWQLAPELVAQLDQALAQ
FT                   ESEQRDDLLQARARFDSAGYPLGNAP"
     MNDLELVRRL DRRLVDDYRL ARNYCLDVPT FALVHLRSIA HRLTTWLGER AELEFHSKNL        60
     YDRIEQLARA KVIDMRLARK LHKLRGDGNK GAHPEKYHLS LEQLVQLAGK SVKDTARLCA       120
     EVFPLLHPDE AVPEWQFEPV DVVAGRELCY RAVMEDDPEA QYLVGLSLKA RSLMQQERAR       180
     SYALANDGQI PDLSDARRVL EQAAYWFRRA AQEHPAARFE HGVALLNGYG GERDPQAAVR       240
     LIAEAAEQGV ADALALVGYF YLAGSQGYGQ DPLKAEHYLK LAAEQDQPEA MANLGVLYYQ       300
     GLLGQPDLAQ ARACSEQAAL AGYPHAQYHL AVMLFAGEGG DADPEAGLSW LRQAAAQHYP       360
     DALADLAQRT LDGDGVDTNP AAAVTLYQEA IQYGRLPRAM FELALAHFDG EVPERDLATA       420
     GQLLHQAFLH AVPDSELAEA IWQLAPELVA QLDQALAQES EQRDDLLQAR ARFDSAGYPL       480
     GNAP                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page