(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE7

CP002209.PE7         Location/Qualifiers
FT   CDS             complement(9850..10761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0007"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="COGs: COG0752 Glycyl-tRNA synthetase alpha subunit;
FT                   InterPro IPR002310: IPR006194; KEGG: vcj:VCD_001489
FT                   glycyl-tRNA synthetase alpha chain; PFAM: glycyl-tRNA
FT                   synthetase alpha subunit; PRIAM: Glycine--tRNA ligase;
FT                   SPTR: A3GYE7 Glycyl-tRNA synthetase, alpha chain; TIGRFAM:
FT                   glycyl-tRNA synthetase, alpha subunit; PFAM: Glycyl-tRNA
FT                   synthetase alpha subunit; TIGRFAM: glycyl-tRNA synthetase,
FT                   tetrameric type, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74221"
FT                   /db_xref="GOA:E1SUL6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUL6"
FT                   /protein_id="ADN74221.1"
FT                   /translation="MQKYDTKTFQGMILALQDYWAQQGCAVVQPLDKEVGAGTSHPLTC
FT                   LRALGPEPFAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVMLKPSPDNIQDLYLGSLRA
FT                   LGVDTQVHDIRFVEDNWENPTLGAWGLGWEVWLDGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGIERLAMYIQGVDNVYDLVWCDGPFGTITYGDVFLQNEIEQSTYNFEHADVDFLFAH
FT                   FDQSEKECQKLLALEKPLPLPAYERILDAAHAFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCKPAK"
     MQKYDTKTFQ GMILALQDYW AQQGCAVVQP LDKEVGAGTS HPLTCLRALG PEPFAAAYVQ        60
     PSRRPTDGRY GENPNRLQHY YQFQVMLKPS PDNIQDLYLG SLRALGVDTQ VHDIRFVEDN       120
     WENPTLGAWG LGWEVWLDGM EVTQFTYFQQ VGGLECKPVT GEITYGIERL AMYIQGVDNV       180
     YDLVWCDGPF GTITYGDVFL QNEIEQSTYN FEHADVDFLF AHFDQSEKEC QKLLALEKPL       240
     PLPAYERILD AAHAFNLLDA RKAISVTERQ RYILRIRTLT KAVAEAYYAS REALGFPMCK       300
     PAK                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page