(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE74

CP002209.PE74        Location/Qualifiers
FT   CDS             complement(92710..93354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0074"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="COGs: COG0586 membrane-associated protein; InterPro
FT                   IPR015414; KEGG: shm:Shewmr7_0412 DedA family protein;
FT                   PFAM: SNARE associated Golgi protein; SPTR: A2UW95 DedA
FT                   family protein; PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74288"
FT                   /db_xref="GOA:E1SVD4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD4"
FT                   /protein_id="ADN74288.1"
FT                   /translation="MRFLPAPTVPMLHTLQTLVTDLSPYLHQYGYLLLALAIAVEGFGI
FT                   PAPGQALLMVSGVLAADGELALHWVLLVAAISAFGGNLVGYFLGQRGDRWLRQKGWLSA
FT                   ATEARLHQFIERHGIAVLLFSRFIEGLKQTMALGCGLARMPLRAFLLGNALATAVWVTL
FT                   FGLGPALLWHERQPLMQFYQAHHNLTWGVGAAAVLTLALTWRWRQRRQATL"
     MRFLPAPTVP MLHTLQTLVT DLSPYLHQYG YLLLALAIAV EGFGIPAPGQ ALLMVSGVLA        60
     ADGELALHWV LLVAAISAFG GNLVGYFLGQ RGDRWLRQKG WLSAATEARL HQFIERHGIA       120
     VLLFSRFIEG LKQTMALGCG LARMPLRAFL LGNALATAVW VTLFGLGPAL LWHERQPLMQ       180
     FYQAHHNLTW GVGAAAVLTL ALTWRWRQRR QATL                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page