(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE77

CP002209.PE77        Location/Qualifiers
FT   CDS             96724..97407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG5587 conserved hypothetical protein;
FT                   InterPro IPR012808; KEGG: pat:Patl_1742 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A2UVH2
FT                   Putative uncharacterized protein; PFAM: Conserved
FT                   hypothetical protein (DUF2461); TIGRFAM: conserved
FT                   hypothetical protein TIGR02453"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74291"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD7"
FT                   /protein_id="ADN74291.1"
FT                   /translation="MIPYIRPETLEFLEQLRVNNSRDWFQANKSRYEACVRGPALDLIA
FT                   SFAPRLASFAPRFRADAKKVGGSLMRPYRDTRFSHDKTPIKTNVGIQFRHDLGKDVHAP
FT                   GYYLHIEPGQCLLGVGCWRPDSPSLAAIREAIDRSPIRWLAARDDGEFCSRFSLSGTSL
FT                   VRPPKGYDKDHPQLEDLKRKDFIGVMPLADEQVMGEGLLDLMEEAYEGADPFMRFLCQA
FT                   MKVPF"
     MIPYIRPETL EFLEQLRVNN SRDWFQANKS RYEACVRGPA LDLIASFAPR LASFAPRFRA        60
     DAKKVGGSLM RPYRDTRFSH DKTPIKTNVG IQFRHDLGKD VHAPGYYLHI EPGQCLLGVG       120
     CWRPDSPSLA AIREAIDRSP IRWLAARDDG EFCSRFSLSG TSLVRPPKGY DKDHPQLEDL       180
     KRKDFIGVMP LADEQVMGEG LLDLMEEAYE GADPFMRFLC QAMKVPF                     227
//

If you have problems or comments...

PBIL Back to PBIL home page