(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE78

CP002209.PE78        Location/Qualifiers
FT   CDS             97555..99327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0078"
FT                   /product="Arylsulfotransferase"
FT                   /note="InterPro IPR010262; KEGG: eic:NT01EI_0602
FT                   hypothetical protein; PFAM: Arylsulfotransferase; PFAM:
FT                   Arylsulfotransferase (ASST)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74292"
FT                   /db_xref="GOA:E1SVD8"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD8"
FT                   /protein_id="ADN74292.1"
FT                   /translation="MLKRVVLAMAAMGIMGSAAAVSLPPAPAVGKLGAVVVDPYGTAPL
FT                   TAVIELAGKSISDVHVTVEGKGPEGVSIDYPVGRHSLLTHDGIPVFGLYANHLNNVTVR
FT                   YQMAGQPVEEHYRILTGSLQNRYIDNRSTSELQPVEVKTVAPGFEDRLYLVNSHTLLPQ
FT                   GSDLHWGALKDASSGLLDANPAGGSMPFDAIPMTYIIDTQGEYRWWLSQDALYDGKNHD
FT                   VDRRGYLMGINPTATGSYTFVQGQRWYEMDLMGRFAHDQKLPRGFIDASHESVETPQGT
FT                   VLLRVAKRNYLRDDGQMVHTVRDHIIEVDKSGNLLDVWDLPVILDPLRDDLIKALDASA
FT                   VCVSRNVDAEGQAVVLEPDAPFGDAVGVGAGRNWAHVNSIAYDPSDDSIIISPRHQASA
FT                   IKIGRDKQVKWILSASIGWSGELADKLLTPVDAKGNPLDCTVKGVCEGDFDFSYTQHTA
FT                   WLSDKGTLTVFDNGDGRHYRQPFFKTERYSRAVEYKIDEKAMTVQQLWEYGKERGYDWF
FT                   SPITSNAEYQSDRDTMFTFGGSIHLFEGASIIGKINEIDYDTKAVKVEIDVISDKTNSP
FT                   HYRALVVQPEQAFR"
     MLKRVVLAMA AMGIMGSAAA VSLPPAPAVG KLGAVVVDPY GTAPLTAVIE LAGKSISDVH        60
     VTVEGKGPEG VSIDYPVGRH SLLTHDGIPV FGLYANHLNN VTVRYQMAGQ PVEEHYRILT       120
     GSLQNRYIDN RSTSELQPVE VKTVAPGFED RLYLVNSHTL LPQGSDLHWG ALKDASSGLL       180
     DANPAGGSMP FDAIPMTYII DTQGEYRWWL SQDALYDGKN HDVDRRGYLM GINPTATGSY       240
     TFVQGQRWYE MDLMGRFAHD QKLPRGFIDA SHESVETPQG TVLLRVAKRN YLRDDGQMVH       300
     TVRDHIIEVD KSGNLLDVWD LPVILDPLRD DLIKALDASA VCVSRNVDAE GQAVVLEPDA       360
     PFGDAVGVGA GRNWAHVNSI AYDPSDDSII ISPRHQASAI KIGRDKQVKW ILSASIGWSG       420
     ELADKLLTPV DAKGNPLDCT VKGVCEGDFD FSYTQHTAWL SDKGTLTVFD NGDGRHYRQP       480
     FFKTERYSRA VEYKIDEKAM TVQQLWEYGK ERGYDWFSPI TSNAEYQSDR DTMFTFGGSI       540
     HLFEGASIIG KINEIDYDTK AVKVEIDVIS DKTNSPHYRA LVVQPEQAFR                  590
//

If you have problems or comments...

PBIL Back to PBIL home page