(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE87

CP002209.PE87        Location/Qualifiers
FT   CDS             107014..107892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0087"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: saz:Sama_3430 cation efflux family
FT                   protein; PFAM: cation efflux protein; SPTR: A2UXD4 Cation
FT                   diffusion facilitator family transporter; TIGRFAM: cation
FT                   diffusion facilitator family transporter; PFAM: Cation
FT                   efflux family; TIGRFAM: cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74301"
FT                   /db_xref="GOA:E1SW01"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW01"
FT                   /protein_id="ADN74301.1"
FT                   /translation="MSSSTTPEQYAFWIRVATRASVATAVILILAKLLAWSFSGSASLL
FT                   ASLTDSMMDAMASLVNFYALRVALLPADQHHRFGHGKAEPLATLVQAGFILGSALLLLF
FT                   HGSERLINPTPLTNSTLGIGVSVFAMVATVVLLTIQKRAVAVTGSTAIAADALHYRTDL
FT                   LLNAAVLLALVLASQGLLWADGLFAVLIALYIGYGAWGLGSEAVQLLLDREAEPEVREQ
FT                   VEALAKADPGVQGLHDLRTRRSGNTLYVQMHLELDGDLPLREAHDLADAVECRIREAFP
FT                   GADVIVHQDPV"
     MSSSTTPEQY AFWIRVATRA SVATAVILIL AKLLAWSFSG SASLLASLTD SMMDAMASLV        60
     NFYALRVALL PADQHHRFGH GKAEPLATLV QAGFILGSAL LLLFHGSERL INPTPLTNST       120
     LGIGVSVFAM VATVVLLTIQ KRAVAVTGST AIAADALHYR TDLLLNAAVL LALVLASQGL       180
     LWADGLFAVL IALYIGYGAW GLGSEAVQLL LDREAEPEVR EQVEALAKAD PGVQGLHDLR       240
     TRRSGNTLYV QMHLELDGDL PLREAHDLAD AVECRIREAF PGADVIVHQD PV               292
//

If you have problems or comments...

PBIL Back to PBIL home page