(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE89

CP002209.PE89        Location/Qualifiers
FT   CDS             complement(109348..110403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0089"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.13.3"
FT                   /note="COGs: COG3852 Signal transduction histidine kinase
FT                   nitrogen specific; InterPro IPR004358: IPR013767:
FT                   IPR013656: IPR003594: IPR 003661: IPR000014: IPR005467;
FT                   KEGG: shw:Sputw3181_0222 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein; SPTR:
FT                   A2UXD7 Sensor protein; PFAM: Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74303"
FT                   /db_xref="GOA:E1SW03"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW03"
FT                   /protein_id="ADN74303.1"
FT                   /translation="MDRQSDPDYLHQLSTAVLVLTPQLQVRYANHAAEQLLGLGQRRLL
FT                   GQNAASLYSQLATDTALLRQTLEREQGQSLYAVSLVTLDGQHHTIDLIFTPLESAEILV
FT                   EARVVDHQQRISQELQHYAQQHAAQLLVRGLAHEIKNPLGGLRGAAQLLERELDDPELK
FT                   EFTTIIIEQSDRLRGLVDRLLGPQYPGTWAEGNVHRLLEQVARLCEMEATGTLVIERDY
FT                   DPSIPDFVMDAEQLQQALLNIVRNAVQALDGQGRIVLRTRSQGQTTIAGRRHRQVVAVS
FT                   VVDDGPGIDPSIQDTLFYPMVTNKADGSGLGLSIAQKIVSQHQGRIELESWPGHTEFTL
FT                   LLPMTFSKEAQ"
     MDRQSDPDYL HQLSTAVLVL TPQLQVRYAN HAAEQLLGLG QRRLLGQNAA SLYSQLATDT        60
     ALLRQTLERE QGQSLYAVSL VTLDGQHHTI DLIFTPLESA EILVEARVVD HQQRISQELQ       120
     HYAQQHAAQL LVRGLAHEIK NPLGGLRGAA QLLERELDDP ELKEFTTIII EQSDRLRGLV       180
     DRLLGPQYPG TWAEGNVHRL LEQVARLCEM EATGTLVIER DYDPSIPDFV MDAEQLQQAL       240
     LNIVRNAVQA LDGQGRIVLR TRSQGQTTIA GRRHRQVVAV SVVDDGPGID PSIQDTLFYP       300
     MVTNKADGSG LGLSIAQKIV SQHQGRIELE SWPGHTEFTL LLPMTFSKEA Q                351
//

If you have problems or comments...

PBIL Back to PBIL home page