(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE94

CP002209.PE94        Location/Qualifiers
FT   CDS             complement(115982..116836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0094"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="InterPro IPR002575; KEGG: maq:Maqu_0783 hypothetical
FT                   protein; PFAM: aminoglycoside phosphotransferase; PFAM:
FT                   Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74308"
FT                   /db_xref="GOA:E1SW08"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW08"
FT                   /protein_id="ADN74308.1"
FT                   /translation="MKPTVSGNSGCQLSLTQRNGVIVVQKRATTAAYAPRLRAQIDKQR
FT                   CAARRNRLPGVHIPAIVAEQPSPQGYCAWMEYLNYQDYSQFFATASLAKLDRLARHLID
FT                   FIEAELAEATLTEVPAQHFLDKLDAIARQLPGLANRDAKQAQLAALARRVKAQPVVLPL
FT                   GPNHGDLTLANLMVSQDASRIGLFDFLDSYLDSPLVDIAKVRQDTQFHWSRLMTRARID
FT                   RARYRIVMRYLDQQIDQHFHAYPWYRQHYTLIQGINIARIFPYEHQPQVSDFTHNTLTQ
FT                   LGF"
     MKPTVSGNSG CQLSLTQRNG VIVVQKRATT AAYAPRLRAQ IDKQRCAARR NRLPGVHIPA        60
     IVAEQPSPQG YCAWMEYLNY QDYSQFFATA SLAKLDRLAR HLIDFIEAEL AEATLTEVPA       120
     QHFLDKLDAI ARQLPGLANR DAKQAQLAAL ARRVKAQPVV LPLGPNHGDL TLANLMVSQD       180
     ASRIGLFDFL DSYLDSPLVD IAKVRQDTQF HWSRLMTRAR IDRARYRIVM RYLDQQIDQH       240
     FHAYPWYRQH YTLIQGINIA RIFPYEHQPQ VSDFTHNTLT QLGF                        284
//

If you have problems or comments...

PBIL Back to PBIL home page