(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE96

CP002209.PE96        Location/Qualifiers
FT   CDS             complement(118076..118951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0096"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: swp:swp_0095 GGDEF domain protein; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   SPTR: A3WK31 Signaling protein with membrane-bound sensor
FT                   domain and GGDEF domain; TIGRFAM: diguanylate cyclase;
FT                   PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74310"
FT                   /db_xref="GOA:E1SW10"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW10"
FT                   /protein_id="ADN74310.1"
FT                   /translation="MERTRTLRIIGLWIALMLGISALVLARADAKPLAIWDWWDIALET
FT                   SLLVLISTWLVMVAQARPGGRITRWLLAGLLAFGCGSVVDLLDEFVRLDTLPTGFALLE
FT                   KGPVPLGLISLTIGLWGWRKEQLRINQQLRTREQFLREADHIDPLTQLCDARTFDAHLQ
FT                   RLAQKGTSCSVMMLDLDQFHRFNHDHGMAAGDELLHRFSHALANEVRHCDLICRYAGDR
FT                   FVVLLPRCPASLAAALAEHLRQQLPEPRISVTAVYLYRGEGPFEAQSLLAELNQRMIDA
FT                   KAHRQWAKAG"
     MERTRTLRII GLWIALMLGI SALVLARADA KPLAIWDWWD IALETSLLVL ISTWLVMVAQ        60
     ARPGGRITRW LLAGLLAFGC GSVVDLLDEF VRLDTLPTGF ALLEKGPVPL GLISLTIGLW       120
     GWRKEQLRIN QQLRTREQFL READHIDPLT QLCDARTFDA HLQRLAQKGT SCSVMMLDLD       180
     QFHRFNHDHG MAAGDELLHR FSHALANEVR HCDLICRYAG DRFVVLLPRC PASLAAALAE       240
     HLRQQLPEPR ISVTAVYLYR GEGPFEAQSL LAELNQRMID AKAHRQWAKA G                291
//

If you have problems or comments...

PBIL Back to PBIL home page