(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE99

CP002209.PE99        Location/Qualifiers
FT   CDS             complement(123825..124457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3911 hypothetical protein; SPTR:
FT                   A0XX50 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2959)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74313"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW13"
FT                   /protein_id="ADN74313.1"
FT                   /translation="MRVLPLLFVLALTGCQSAYYAAAEQVGYHKREILVDRVEDAQESQ
FT                   QEAQEQFSSALEQMKTLINFDGGDLEAAYDKVKGEYEDSADAAADVSSRINAVADVAEA
FT                   MFDEWEDELAQYQSASLRRDSESQLRDTRRRYDAMLRAMRQAEDKMEPVLKRLKDNELY
FT                   LKHNLNARAIGAVGKEFGVLEQEVERVIAEMNRAIAESDKFIQTLNP"
     MRVLPLLFVL ALTGCQSAYY AAAEQVGYHK REILVDRVED AQESQQEAQE QFSSALEQMK        60
     TLINFDGGDL EAAYDKVKGE YEDSADAAAD VSSRINAVAD VAEAMFDEWE DELAQYQSAS       120
     LRRDSESQLR DTRRRYDAML RAMRQAEDKM EPVLKRLKDN ELYLKHNLNA RAIGAVGKEF       180
     GVLEQEVERV IAEMNRAIAE SDKFIQTLNP                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page