(data stored in ACNUC7421 zone)

EMBL: CP002293.PE10

CP002293.PE10        Location/Qualifiers
FT   CDS             18645..19997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0010"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: gwc:GWCH70_0010 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72866"
FT                   /db_xref="GOA:A0A0F6BHG5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG5"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ADP72866.1"
FT                   /translation="MKRIKQKIIIIFLMIGLCFYFLPFHAAKAAVDPLNIEADAAILVD
FT                   ANTGRILYQKNIDTVLGIASMTKMMTEYLLLEAVKEKRVKWDQQYTPSDYVYRLSQDRA
FT                   LSNVPLRKDGKYTIRELYEAMAIYSANAATVAIAEIVGGSEQNFVKMMNEKANQLGLKG
FT                   YKFVNSTGLSNEDLKGFHPEGTNQSEENVMSARSVATLAYHLLKEYPEVLETASTPRKI
FT                   FREGTDDQIKMDNWNWMLPGLVHAYEGVDGLKTGYTEFAGYCFTGTAERNGVRFITVVM
FT                   NAKSNGKSTIEARFEQTRKLLDYGFSNYSMKKLYSKGYELKGKSVLPVVKGKEKSVAIA
FT                   TDKPLSLVVKNGEEKNYRPVYVFDKKKLTADGELTAPVKKGEKVGYMTLQYKGEEEYSF
FT                   LSPEMKKNVSVDIVAKNNVEKANWFVLTMRGIGGLFGDVWTSVAKTVKGWF"
     MKRIKQKIII IFLMIGLCFY FLPFHAAKAA VDPLNIEADA AILVDANTGR ILYQKNIDTV        60
     LGIASMTKMM TEYLLLEAVK EKRVKWDQQY TPSDYVYRLS QDRALSNVPL RKDGKYTIRE       120
     LYEAMAIYSA NAATVAIAEI VGGSEQNFVK MMNEKANQLG LKGYKFVNST GLSNEDLKGF       180
     HPEGTNQSEE NVMSARSVAT LAYHLLKEYP EVLETASTPR KIFREGTDDQ IKMDNWNWML       240
     PGLVHAYEGV DGLKTGYTEF AGYCFTGTAE RNGVRFITVV MNAKSNGKST IEARFEQTRK       300
     LLDYGFSNYS MKKLYSKGYE LKGKSVLPVV KGKEKSVAIA TDKPLSLVVK NGEEKNYRPV       360
     YVFDKKKLTA DGELTAPVKK GEKVGYMTLQ YKGEEEYSFL SPEMKKNVSV DIVAKNNVEK       420
     ANWFVLTMRG IGGLFGDVWT SVAKTVKGWF                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page