(data stored in ACNUC7421 zone)

EMBL: CP002293.PE100

CP002293.PE100       Location/Qualifiers
FT   CDS             120792..121160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0100"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: gtn:GTNG_0096 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72956"
FT                   /db_xref="GOA:A0A0F6BHQ5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ5"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADP72956.1"
FT                   /translation="MTKEQIIEAIKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAA
FT                   GGDAAAEKTEFDVILADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPLKEGVSKEE
FT                   AEEIKAKLEEVGASVELK"
     MTKEQIIEAI KNMTVLELNE LVKAIEEEFG VTAAAPVVVA GGAAAGGDAA AEKTEFDVIL        60
     ADAGAQKIKV IKVVREITGL GLKEAKDLVD NTPKPLKEGV SKEEAEEIKA KLEEVGASVE       120
     LK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page