(data stored in ACNUC7421 zone)

EMBL: CP002293.PE102

CP002293.PE102       Location/Qualifiers
FT   CDS             122087..125659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0102"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="KEGG: gwc:GWCH70_0103 DNA-directed RNA polymerase,
FT                   beta subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2 domain 2; RNA polymerase
FT                   Rpb2 domain 3; DNA-directed RNA polymerase, beta subunit,
FT                   external 1 domain; RNA polymerase Rpb2 domain 7"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72958"
FT                   /db_xref="GOA:A0A0F6BHQ7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ7"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADP72958.1"
FT                   /translation="MTGRLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYKWFLDEGL
FT                   REMFREISPIEDFSGNLSLEFIDYSLGEPKYTVEEAKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYSEKVDKNGKRGFSATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNEYLRNTLE
FT                   KDNTDSTEKALIEIYERLRPGEPPTIENAKNLLISRFFDPKRYDLASVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEVIAEKGTIVDRRTLNRILPYLENGVGLRVHKPFGGVVEE
FT                   EIALQSIKIYAPNDPDGEQVINVISNGYIAEDVKHITPADIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIAAI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSTYAKVNKFGFIETPYRRVDPETGRVTDQIDYLTADEEDNYVVAQ
FT                   ANVPLAEDGTFLEENVVARFRGENIVVKRDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLLEPEAPIVGTGMEYVSARDSGAAVICKHRGIVERVEAKEIWVRR
FT                   LIEVDGKEVKGDLDKYRLLKFVRSNQGTCYNQRPIVKKGDIVEKGEILADGPSMDKGEL
FT                   ALGRNVLVAFMTWDGYNYEDAIIMSERLVKEDVYTSIHIEEYEAESRDTKLGPEEITRD
FT                   IPNVGEDALKNLDERGIVRIGAEVKDGDLLVGKVTPKGMTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISRILPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVFELHLGMAAKKLGLHIAS
FT                   PVFDGATEEDVWNILEEAGMPRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGENIPEPGVPESFKVLIKELQSLGMDVTILTSDEKEINMENFDEEDDVHSA
FT                   DSLVPEVKSAEDEKAGKKGVATKE"
     MTGRLVQYGR HRQRRSYARI SEVLELPNLI EIQTSSYKWF LDEGLREMFR EISPIEDFSG        60
     NLSLEFIDYS LGEPKYTVEE AKERDVTYAA PLRVKVRLIN KETGEVKEQD VFMGDFPLMT       120
     ETGTFIINGA ERVIVSQLVR SPSVYYSEKV DKNGKRGFSA TVIPNRGAWL EYETDAKDVV       180
     YVRIDRTRKL PVTVLLRALG FGSDQEIIDL IGDNEYLRNT LEKDNTDSTE KALIEIYERL       240
     RPGEPPTIEN AKNLLISRFF DPKRYDLASV GRYKINKKLH IKNRLFNQRL AETLVDPETG       300
     EVIAEKGTIV DRRTLNRILP YLENGVGLRV HKPFGGVVEE EIALQSIKIY APNDPDGEQV       360
     INVISNGYIA EDVKHITPAD IIASISYFFN LLHGVGDTDD IDHLGNRRLR SVGELLQNQF       420
     RIGLSRMERV VRERMSIQDT NTITPQQLIN IRPVIAAIKE FFGSSQLSQF MDQTNPLAEL       480
     THKRRLSALG PGGLTRERAG FEVRDVHYSH YGRMCPIETP EGPNIGLINS LSTYAKVNKF       540
     GFIETPYRRV DPETGRVTDQ IDYLTADEED NYVVAQANVP LAEDGTFLEE NVVARFRGEN       600
     IVVKRDRVDY MDVSPKQVVS AATACIPFLE NDDSNRALMG ANMQRQAVPL LEPEAPIVGT       660
     GMEYVSARDS GAAVICKHRG IVERVEAKEI WVRRLIEVDG KEVKGDLDKY RLLKFVRSNQ       720
     GTCYNQRPIV KKGDIVEKGE ILADGPSMDK GELALGRNVL VAFMTWDGYN YEDAIIMSER       780
     LVKEDVYTSI HIEEYEAESR DTKLGPEEIT RDIPNVGEDA LKNLDERGIV RIGAEVKDGD       840
     LLVGKVTPKG MTELTAEERL LHAIFGEKAR EVRDTSLRVP HGGGGIVLDV KVFNREDGDE       900
     LPPGVNQLVR VYIVQKRKIS EGDKMAGRHG NKGVISRILP EEDMPFLPDG TPIDIMLNPL       960
     GVPSRMNIGQ VFELHLGMAA KKLGLHIASP VFDGATEEDV WNILEEAGMP RDAKTVLYDG      1020
     RTGEPFDNRV SVGIMYMIKL AHMVDDKLHA RSTGPYSLVT QQPLGGKAQF GGQRFGEMEV      1080
     WALEAYGAAY TLQEILTVKS DDVVGRVKTY EAIVKGENIP EPGVPESFKV LIKELQSLGM      1140
     DVTILTSDEK EINMENFDEE DDVHSADSLV PEVKSAEDEK AGKKGVATKE                 1190
//

If you have problems or comments...

PBIL Back to PBIL home page