(data stored in ACNUC7421 zone)

EMBL: CP002293.PE105

CP002293.PE105       Location/Qualifiers
FT   CDS             129875..130297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0105"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: gwc:GWCH70_0106 ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72961"
FT                   /db_xref="GOA:A0A0F6BHR0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR0"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADP72961.1"
FT                   /translation="MPTINQLVRKGREKKVVKSKSPALNKGYNSFKKVQTNVPSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIIRGALDTAGVANRMQGRSKYGAKKPKESKK"
     MPTINQLVRK GREKKVVKSK SPALNKGYNS FKKVQTNVPS PQKRGVCTRV GTMTPKKPNS        60
     ALRKYARVRL TNGIEVTAYI PGIGHNLQEH SVVLIRGGRV KDLPGVRYHI IRGALDTAGV       120
     ANRMQGRSKY GAKKPKESKK                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page