(data stored in SCRATCH zone)

EMBL: CP002293.PE107

CP002293.PE107       Location/Qualifiers
FT   CDS             130948..133026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0107"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain IV; elongation
FT                   factor Tu domain 2 protein; elongation factor G
FT                   domain-containing protein; KEGG: gwc:GWCH70_0108
FT                   translation elongation factor G; SMART: elongation factor G
FT                   domain IV; elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72963"
FT                   /db_xref="GOA:A0A0F6BHR2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR2"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADP72963.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHE
FT                   GAATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAIT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVNTLHERLQANAHPVQ
FT                   LPIGAEDQFSGIIDLVEMCAYHYHDELGKNIERIEIPEEYRDMAEEYHNKLIEAVAELD
FT                   EELMMKYLEGEEITVEELKAAIRRATISVEFFPVFCGSAFKNKGVQLLLDGVVDYLPSP
FT                   VDIPPIKGIVPDTEEEVVRESSDDAPFAALAFKIMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   MNSTKRKRERIGRLLQMHANHRQEISTVYAGDIAAAVGLKDTTTGDTLCDEKNLVVLES
FT                   MEFPEPVINVAIEPKSKADQDKMGQALQKLQEEDPTFRAWTDPETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRKSAQVEGKFIRQSGGRGQYGHVWIEFSPNER
FT                   GKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSS
FT                   EMAFKIAASLALKNAAEKCDPVLLEPIMKVEVIIPEEYLGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPLAEMFGYATSLRSNTQGRGTFTMVFDHYEEVPKNIADEIIKKNKGE"
     MAREFSLEKT RNIGIMAHID AGKTTTTERI LFYTGRVHKI GEVHEGAATM DWMEQEQERG        60
     ITITSAATTA QWKGHRINII DTPGHVDFTV EVERSLRVLD GAITVLDAQS GVEPQTETVW       120
     RQATTYGVPR IVFVNKMDKI GADFLYSVNT LHERLQANAH PVQLPIGAED QFSGIIDLVE       180
     MCAYHYHDEL GKNIERIEIP EEYRDMAEEY HNKLIEAVAE LDEELMMKYL EGEEITVEEL       240
     KAAIRRATIS VEFFPVFCGS AFKNKGVQLL LDGVVDYLPS PVDIPPIKGI VPDTEEEVVR       300
     ESSDDAPFAA LAFKIMTDPY VGKLTFFRVY SGTLDSGSYV MNSTKRKRER IGRLLQMHAN       360
     HRQEISTVYA GDIAAAVGLK DTTTGDTLCD EKNLVVLESM EFPEPVINVA IEPKSKADQD       420
     KMGQALQKLQ EEDPTFRAWT DPETGQTIIA GMGELHLDII VDRMRREFKV EANVGAPQVA       480
     YRETFRKSAQ VEGKFIRQSG GRGQYGHVWI EFSPNERGKG FEFENAIVGG VVPKEYVPAV       540
     QAGLEEAMQN GVLAGYPVVD IKAKLFDGSY HDVDSSEMAF KIAASLALKN AAEKCDPVLL       600
     EPIMKVEVII PEEYLGDIMG DITSRRGRVE GMEARGNAQV VRAMVPLAEM FGYATSLRSN       660
     TQGRGTFTMV FDHYEEVPKN IADEIIKKNK GE                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page