(data stored in SCRATCH zone)

EMBL: CP002293.PE11

CP002293.PE11        Location/Qualifiers
FT   CDS             20146..21030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0011"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="KEGG: gwc:GWCH70_0011 pyridoxine biosynthesis
FT                   protein; TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72867"
FT                   /db_xref="GOA:A0A0F6BHG6"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG6"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ADP72867.1"
FT                   /translation="MAITGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTVIEEVMKAVSIPVMAKARIGHYVEARVLEALGVDYIDES
FT                   EVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQIRKVVSMSEDELVTEAKNLGAPVEVLREIKQLGRLPVVNFAAGGIATPADAA
FT                   LMMHLGADGVFVGSGIFKSENPEKYARAIVEATAHYEDYELIAHLSKGLGGAMRGIDVA
FT                   SLLPEQRMQERGW"
     MAITGTDRVK RGMAEMQKGG VIMDVVNAEQ AKIAEAAGAV AVMALERVPA DIRAAGGVAR        60
     MADPTVIEEV MKAVSIPVMA KARIGHYVEA RVLEALGVDY IDESEVLTPA DEEFHIDKRQ       120
     FTVPFVCGCR DLGEAARRIA EGASMLRTKG EPGTGNIVEA VRHMRKVNAQ IRKVVSMSED       180
     ELVTEAKNLG APVEVLREIK QLGRLPVVNF AAGGIATPAD AALMMHLGAD GVFVGSGIFK       240
     SENPEKYARA IVEATAHYED YELIAHLSKG LGGAMRGIDV ASLLPEQRMQ ERGW             294
//

If you have problems or comments...

PBIL Back to PBIL home page