(data stored in ACNUC7421 zone)

EMBL: CP002293.PE112

CP002293.PE112       Location/Qualifiers
FT   CDS             136266..136553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0112"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: ribosomal
FT                   protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72968"
FT                   /db_xref="GOA:A0A0F6BHR7"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR7"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADP72968.1"
FT                   /translation="MKDPRDIIKRPIITENTMNLISQKKYTFEVDVNANKTEVKDAVEK
FT                   IFGVKVAKVNIMNYKGKFKRVGRYSGYTNRRRKAIVTLTPDSKEIELFEV"
     MKDPRDIIKR PIITENTMNL ISQKKYTFEV DVNANKTEVK DAVEKIFGVK VAKVNIMNYK        60
     GKFKRVGRYS GYTNRRRKAI VTLTPDSKEI ELFEV                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page