(data stored in ACNUC7421 zone)

EMBL: CP002293.PE115

CP002293.PE115       Location/Qualifiers
FT   CDS             137766..138107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0115"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: ribosomal protein L22; TIGRFAM: ribosomal
FT                   protein L22; PFAM: ribosomal protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72971"
FT                   /db_xref="GOA:A0A0F6BHS0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS0"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADP72971.1"
FT                   /translation="MEAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASP
FT                   IIEKVLKSAVANAEHNYDMDVNNLVITKAYVDEGPTLKRFRPRAMGRASAINKRTSHIT
FT                   IVVSEKKEG"
     MEAKAVARTV RIAPRKARLV IDLIRGKEVG EAFAILRHTP KAASPIIEKV LKSAVANAEH        60
     NYDMDVNNLV ITKAYVDEGP TLKRFRPRAM GRASAINKRT SHITIVVSEK KEG              113
//

If you have problems or comments...

PBIL Back to PBIL home page