(data stored in ACNUC7421 zone)

EMBL: CP002293.PE117

CP002293.PE117       Location/Qualifiers
FT   CDS             138770..139204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0117"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: gwc:GWCH70_0118 ribosomal protein L16;
FT                   TIGRFAM: ribosomal protein L16; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72973"
FT                   /db_xref="GOA:A0A0F6BHS2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS2"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADP72973.1"
FT                   /translation="MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEYGLQALESAWITNR
FT                   QIEAARRAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMF
FT                   EVGGVSEEVAREALRLASHKLPIKCKFVKREESGGEANES"
     MLMPKRVKYR REHRGRMKGR AKGGTEVHFG EYGLQALESA WITNRQIEAA RRAMTRYMKR        60
     GGKVWIKIFP SKPYTAKPLE VRMGSGKGAP EGWVAVVKPG KVMFEVGGVS EEVAREALRL       120
     ASHKLPIKCK FVKREESGGE ANES                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page