(data stored in SCRATCH zone)

EMBL: CP002293.PE119

CP002293.PE119       Location/Qualifiers
FT   CDS             139424..139687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0119"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: gwc:GWCH70_0120 ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72975"
FT                   /db_xref="GOA:A0A0F6BHS4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS4"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADP72975.1"
FT                   /translation="MSERNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKK
FT                   YKAHDENNIAKVGDIVKIMETRPLSATKRFRLVEIVEKAVIV"
     MSERNQRKVY VGRVVSDKMD KTITVLVETY KKHPLYGKRV KYSKKYKAHD ENNIAKVGDI        60
     VKIMETRPLS ATKRFRLVEI VEKAVIV                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page