(data stored in ACNUC7421 zone)

EMBL: CP002293.PE120

CP002293.PE120       Location/Qualifiers
FT   CDS             139736..140104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0120"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: gwc:GWCH70_0121 ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72976"
FT                   /db_xref="GOA:A0A0F6BHS5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS5"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADP72976.1"
FT                   /translation="MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKE
FT                   ATPGGVVKKGQVVKAVVVRTKRGVRRSDGSYIRFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDKDFMKIISLAPEVI"
     MIQQESRLKV ADNSGAREVL VIKVLGGSGR RYANIGDVVV ATVKEATPGG VVKKGQVVKA        60
     VVVRTKRGVR RSDGSYIRFD ENACVIIRDD KSPRGTRIFG PVARELRDKD FMKIISLAPE       120
     VI                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page