(data stored in SCRATCH zone)

EMBL: CP002293.PE121

CP002293.PE121       Location/Qualifiers
FT   CDS             140142..140450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0121"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: gwc:GWCH70_0122 ribosomal protein L24;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72977"
FT                   /db_xref="GOA:A0A0F6BHS6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS6"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADP72977.1"
FT                   /translation="MHVKKGDKVQVISGKDKGKQGVILAAFPKKNRVIVEGVNIVKKHA
FT                   KPSQANPQGGIITKEAPIHVSKVMPLDPKTGLPTRIGYKIVDGKKVRYAKRSGEILD"
     MHVKKGDKVQ VISGKDKGKQ GVILAAFPKK NRVIVEGVNI VKKHAKPSQA NPQGGIITKE        60
     APIHVSKVMP LDPKTGLPTR IGYKIVDGKK VRYAKRSGEI LD                          102
//

If you have problems or comments...

PBIL Back to PBIL home page