(data stored in ACNUC7421 zone)

EMBL: CP002293.PE122

CP002293.PE122       Location/Qualifiers
FT   CDS             140481..141020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0122"
FT                   /product="ribosomal protein L5"
FT                   /note="KEGG: gwc:GWCH70_0123 ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72978"
FT                   /db_xref="GOA:A0A0F6BHS7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS7"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0123"
FT                   /protein_id="ADP72978.1"
FT                   /translation="MNRLKEKYLKEVTPALMSKFNYKSVMQVPKIEKIVINMGVGDAVQ
FT                   NPKALDSAVEELTLIAGQKPVVTRAKKSIAGFRLRAGMPIGAKVTLRGERMYEFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTAETD
FT                   EEARELLALLGMPFQK"
     MNRLKEKYLK EVTPALMSKF NYKSVMQVPK IEKIVINMGV GDAVQNPKAL DSAVEELTLI        60
     AGQKPVVTRA KKSIAGFRLR AGMPIGAKVT LRGERMYEFL DKLISVSLPR VRDFRGVSKK       120
     SFDGRGNYTL GIKEQLIFPE IDYDKVNKVR GMDIVIVTTA ETDEEARELL ALLGMPFQK        179
//

If you have problems or comments...

PBIL Back to PBIL home page