(data stored in SCRATCH zone)

EMBL: CP002293.PE129

CP002293.PE129       Location/Qualifiers
FT   CDS             143379..143819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0129"
FT                   /product="ribosomal protein L15"
FT                   /note="KEGG: gwc:GWCH70_0130 ribosomal protein L15;
FT                   TIGRFAM: ribosomal protein L15; PFAM: Ribosomal protein
FT                   L18e/L15"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72985"
FT                   /db_xref="GOA:A0A0F6BHT4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT4"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADP72985.1"
FT                   /translation="MKLHELQPAPGSRKERTRVGRGIGSGKGKTSGRGQKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEYAIVNLEKLNRFEDGTEVTPELLLETGVISK
FT                   LKSGVKILGKGQIEKKLTVKAHKFSSSAKEAIEAAGGKTEVI"
     MKLHELQPAP GSRKERTRVG RGIGSGKGKT SGRGQKGQNA RSGGGVRLGF EGGQTPLFRR        60
     LPKRGFTNIN RKEYAIVNLE KLNRFEDGTE VTPELLLETG VISKLKSGVK ILGKGQIEKK       120
     LTVKAHKFSS SAKEAIEAAG GKTEVI                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page