(data stored in ACNUC7421 zone)

EMBL: CP002293.PE131

CP002293.PE131       Location/Qualifiers
FT   CDS             145164..145814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0131"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: gwc:GWCH70_0132 adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72987"
FT                   /db_xref="GOA:A0A0F6BHT6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT6"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADP72987.1"
FT                   /translation="MNLVLMGLPGAGKGTQAEKIVETYGIPHISTGDMFRAAIKEGTPL
FT                   GLQAKEYMDRGDLVPDEVTIGIVRERLSKDDCHKGFLLDGFPRTVAQAEALENILAELT
FT                   RSIDYVIHIQVDKDILMERLTGRRICKNCGATYHLVFNPPANPGVCDKCGGELYQRADD
FT                   NEETVANRLEVNVKQMQPLLEFYEKKGYLRHIDGQQDIEKVFADIRELLGGLQ"
     MNLVLMGLPG AGKGTQAEKI VETYGIPHIS TGDMFRAAIK EGTPLGLQAK EYMDRGDLVP        60
     DEVTIGIVRE RLSKDDCHKG FLLDGFPRTV AQAEALENIL AELTRSIDYV IHIQVDKDIL       120
     MERLTGRRIC KNCGATYHLV FNPPANPGVC DKCGGELYQR ADDNEETVAN RLEVNVKQMQ       180
     PLLEFYEKKG YLRHIDGQQD IEKVFADIRE LLGGLQ                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page