(data stored in ACNUC7421 zone)

EMBL: CP002293.PE135

CP002293.PE135       Location/Qualifiers
FT   CDS             147049..147414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0135"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: gwc:GWCH70_0136 ribosomal protein S13;
FT                   TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal protein
FT                   S13"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72991"
FT                   /db_xref="GOA:A0A0F6BHU0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU0"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADP72991.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIYGIGKSTAKKILAEAGVSEDTRV
FT                   RDLTEEELGRIREIVSRLKVEGDLRREVSLNIKRLIEIGCYRGLRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
     MARIAGVDIP RDKRVVISLT YIYGIGKSTA KKILAEAGVS EDTRVRDLTE EELGRIREIV        60
     SRLKVEGDLR REVSLNIKRL IEIGCYRGLR HRRGLPVRGQ NTKNNARTRK GPRRTVANKK       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page