(data stored in SCRATCH zone)

EMBL: CP002293.PE136

CP002293.PE136       Location/Qualifiers
FT   CDS             147440..147829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0136"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: gwc:GWCH70_0137 ribosomal protein S11;
FT                   TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72992"
FT                   /db_xref="GOA:A0A0F6BHU1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU1"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADP72992.1"
FT                   /translation="MARKTNTRKRRVRKNIETGIAHIRSTFNNTIVTITDVHGNTIAWS
FT                   SAGALGFKGSRKSTPFAAQMAAEAAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAG
FT                   LEITAIKDVTPIPHNGCRPPKRRRV"
     MARKTNTRKR RVRKNIETGI AHIRSTFNNT IVTITDVHGN TIAWSSAGAL GFKGSRKSTP        60
     FAAQMAAEAA AKASMEHGMK TVEVNVKGPG AGREAAIRAL QAAGLEITAI KDVTPIPHNG       120
     CRPPKRRRV                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page