(data stored in SCRATCH zone)

EMBL: CP002293.PE137

CP002293.PE137       Location/Qualifiers
FT   CDS             147999..148943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0137"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase alpha subunit domain protein; RNA
FT                   polymerase insert; RNA polymerase dimerisation; KEGG:
FT                   gwc:GWCH70_0138 DNA-directed RNA polymerase, alpha subunit;
FT                   SMART: RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72993"
FT                   /db_xref="GOA:A0A0F6BHU2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU2"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADP72993.1"
FT                   /translation="MIEIEKPRIETVEISEDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSVQIDGVLHEFSTIDGVVEDVTAIILNIKKLALKIYSDEEKTLEIDAQGE
FT                   GVVTAADITHDSDVEILNPDLHIATLAEGGRLRMRMTAKRGRGYVPAEANKREDQPIGV
FT                   IPIDSIYTPVSRVAYQVENTRVGQVTDYDKLTIDVWTDGSIGPKEAIALGAKILTEHLN
FT                   IFVSLTDEAQNAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTQKT
FT                   EEDMMKVRNLGRKSLEEVKAKLAELGLSLRKDD"
     MIEIEKPRIE TVEISEDAKY GKFVVEPLER GYGTTLGNSL RRILLSSLPG AAVTSVQIDG        60
     VLHEFSTIDG VVEDVTAIIL NIKKLALKIY SDEEKTLEID AQGEGVVTAA DITHDSDVEI       120
     LNPDLHIATL AEGGRLRMRM TAKRGRGYVP AEANKREDQP IGVIPIDSIY TPVSRVAYQV       180
     ENTRVGQVTD YDKLTIDVWT DGSIGPKEAI ALGAKILTEH LNIFVSLTDE AQNAEIMVEK       240
     EEDQKEKVLE MTIEELDLSV RSYNCLKRAG INTVQELTQK TEEDMMKVRN LGRKSLEEVK       300
     AKLAELGLSL RKDD                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page