(data stored in ACNUC7421 zone)

EMBL: CP002293.PE139

CP002293.PE139       Location/Qualifiers
FT   CDS             149540..150379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0139"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gwc:GWCH70_0140 ABC transporter related; PFAM:
FT                   ABC transporter related; Cobalt ATP-binding cassette-like;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72995"
FT                   /db_xref="GOA:A0A0F6BHU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP72995.1"
FT                   /translation="MEDTILSVEKLYFRYPNQSDYAVQNVTFQVKRGEWLAIVGHNGSG
FT                   KSTIAKLLIGLLKPESGVIKLFHHVLDEQTVWEIRRRIGMVFQNPDNQFVGTTVEDDVA
FT                   FALENNGIPRDEMVKRVHEAIRQVQMEEFLHHEPHHLSGGQKQRVAIAGILALRPDLII
FT                   LDEATSMLDPKGRQEVLDTVRNLNKKQRITVLSITHDLEEVAKADRVIVMNKGEMMAEG
FT                   TPKQIFALGTKLERIGLDLPFAVKVRERLKQRGIPLSSSYFTIEELVEELWTLYLKR"
     MEDTILSVEK LYFRYPNQSD YAVQNVTFQV KRGEWLAIVG HNGSGKSTIA KLLIGLLKPE        60
     SGVIKLFHHV LDEQTVWEIR RRIGMVFQNP DNQFVGTTVE DDVAFALENN GIPRDEMVKR       120
     VHEAIRQVQM EEFLHHEPHH LSGGQKQRVA IAGILALRPD LIILDEATSM LDPKGRQEVL       180
     DTVRNLNKKQ RITVLSITHD LEEVAKADRV IVMNKGEMMA EGTPKQIFAL GTKLERIGLD       240
     LPFAVKVRER LKQRGIPLSS SYFTIEELVE ELWTLYLKR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page