(data stored in ACNUC7421 zone)

EMBL: CP002293.PE14

CP002293.PE14        Location/Qualifiers
FT   CDS             complement(23540..24208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0014"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: gwc:GWCH70_0015
FT                   deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72870"
FT                   /db_xref="GOA:A0A0F6BHG9"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG9"
FT                   /inference="protein motif:PFAM:PF01712"
FT                   /protein_id="ADP72870.1"
FT                   /translation="MNLREKYRIPDNAIITIAGTVGVGKSTMTKALAKALNFRTSLEKV
FT                   DTNPYLDKFYADFERWSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDAHIFAKMH
FT                   FENGTMTAVDYETYTSLFQAMVMTPYFPHPDLLIYLEGSFEEVIKRIRERGRPMEQKTP
FT                   VSYWKEMYERYEKWINEFNACPVLRVNINEYDIIEDEQSIEPIIKKAATIIHEYYHIKK
FT                   "
     MNLREKYRIP DNAIITIAGT VGVGKSTMTK ALAKALNFRT SLEKVDTNPY LDKFYADFER        60
     WSFHLQIYFL AERFKEQKRM FEYGGGFVQD RSIYEDAHIF AKMHFENGTM TAVDYETYTS       120
     LFQAMVMTPY FPHPDLLIYL EGSFEEVIKR IRERGRPMEQ KTPVSYWKEM YERYEKWINE       180
     FNACPVLRVN INEYDIIEDE QSIEPIIKKA ATIIHEYYHI KK                          222
//

If you have problems or comments...

PBIL Back to PBIL home page