(data stored in ACNUC7421 zone)

EMBL: CP002293.PE141

CP002293.PE141       Location/Qualifiers
FT   CDS             151223..152017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0141"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG:
FT                   gwc:GWCH70_0142 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72997"
FT                   /db_xref="GOA:A0A0F6BHU6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU6"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADP72997.1"
FT                   /translation="MNSMIIGKYVPGDSVIHRMDPRAKLLVIFLYVFIVFLANNSITYA
FT                   VLSIFTFSLVALSRIPFSFVLKGLKPIIWIVAITFLLHIFMTKEGDVLYQIGSFSIYES
FT                   GVKQGIFISLRFLLLIMITTLLTLTTTPIEVTDGVESLLGPLKKVHVPVHELALMMSIS
FT                   LRFIPTLMEETEKIIKAQTARGVDFTGGPFSERIKAIVSLLVPLFISSFKRAEELAIAM
FT                   EARGYRGGEGRTKFRQLVWKWTDTAFLAAVLVLAVVLFILRS"
     MNSMIIGKYV PGDSVIHRMD PRAKLLVIFL YVFIVFLANN SITYAVLSIF TFSLVALSRI        60
     PFSFVLKGLK PIIWIVAITF LLHIFMTKEG DVLYQIGSFS IYESGVKQGI FISLRFLLLI       120
     MITTLLTLTT TPIEVTDGVE SLLGPLKKVH VPVHELALMM SISLRFIPTL MEETEKIIKA       180
     QTARGVDFTG GPFSERIKAI VSLLVPLFIS SFKRAEELAI AMEARGYRGG EGRTKFRQLV       240
     WKWTDTAFLA AVLVLAVVLF ILRS                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page