(data stored in ACNUC7421 zone)

EMBL: CP002293.PE142

CP002293.PE142       Location/Qualifiers
FT   CDS             152032..152778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0142"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="KEGG: gwc:GWCH70_0143 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72998"
FT                   /db_xref="GOA:A0A0F6BHU7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU7"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADP72998.1"
FT                   /translation="MSKRIKCTLSYDGTHFFGYQIQPGKRTVQGELEQALEQIHKGKAI
FT                   RVTASGRTDAGVHAYGQVIHFDTFLSLSPEQWKKALNALLPDDIVIKDAQEAAPSFHAR
FT                   FSATAKEYRYKVRIAQERDVFLRHYCYHYPYPLDMEAMGRALRLIEGTHDFTSFCSAKT
FT                   DVDDRVRTIYKADMTVRDDLLEFRFIGNGFLYNMVRIIVGTILEVGQGKRSVDSISSAL
FT                   AAKDRRFAGKTAPPQGLYLWKVYYDN"
     MSKRIKCTLS YDGTHFFGYQ IQPGKRTVQG ELEQALEQIH KGKAIRVTAS GRTDAGVHAY        60
     GQVIHFDTFL SLSPEQWKKA LNALLPDDIV IKDAQEAAPS FHARFSATAK EYRYKVRIAQ       120
     ERDVFLRHYC YHYPYPLDME AMGRALRLIE GTHDFTSFCS AKTDVDDRVR TIYKADMTVR       180
     DDLLEFRFIG NGFLYNMVRI IVGTILEVGQ GKRSVDSISS ALAAKDRRFA GKTAPPQGLY       240
     LWKVYYDN                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page