(data stored in ACNUC7421 zone)

EMBL: CP002293.PE143

CP002293.PE143       Location/Qualifiers
FT   CDS             152933..153370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0143"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: gwc:GWCH70_0144 ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72999"
FT                   /db_xref="GOA:A0A0F6BHU8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU8"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADP72999.1"
FT                   /translation="MRTTYMAKPNEVERKWYVVDAAGKTLGRLASEVAAILRGKHKPTF
FT                   TPHVDCGDHVIIINAEKIELTGKKLTKKLYYRHSLHPGGLKVRTALEMRTNYPEQMLER
FT                   AVRGMLPKGRLGRQMFKKLHVYRGSEHPHQAQKPEVYELRG"
     MRTTYMAKPN EVERKWYVVD AAGKTLGRLA SEVAAILRGK HKPTFTPHVD CGDHVIIINA        60
     EKIELTGKKL TKKLYYRHSL HPGGLKVRTA LEMRTNYPEQ MLERAVRGML PKGRLGRQMF       120
     KKLHVYRGSE HPHQAQKPEV YELRG                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page