(data stored in ACNUC7421 zone)

EMBL: CP002293.PE144

CP002293.PE144       Location/Qualifiers
FT   CDS             153393..153785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0144"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: gwc:GWCH70_0145
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73000"
FT                   /db_xref="GOA:A0A0F6BHU9"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU9"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADP73000.1"
FT                   /translation="MAQVQYYGTGRRKTSVARVRLVPGDGRIVINDRDIRDYIPSEALI
FT                   EIVKQPLVLTETLGNYDVLVNVKGGGFSGQAGAIRHGIARALLQVDPDYRPILKRAGLL
FT                   TRDARVKERKKYGLKGARRAPQFSKR"
     MAQVQYYGTG RRKTSVARVR LVPGDGRIVI NDRDIRDYIP SEALIEIVKQ PLVLTETLGN        60
     YDVLVNVKGG GFSGQAGAIR HGIARALLQV DPDYRPILKR AGLLTRDARV KERKKYGLKG       120
     ARRAPQFSKR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page