(data stored in ACNUC7421 zone)

EMBL: CP002293.PE145

CP002293.PE145       Location/Qualifiers
FT   CDS             153897..154337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0145"
FT                   /product="Protein of unknown function DUF2521"
FT                   /note="PFAM: Protein of unknown function DUF2521; KEGG:
FT                   gwc:GWCH70_0146 conserved hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73001"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV0"
FT                   /inference="protein motif:PFAM:PF10730"
FT                   /protein_id="ADP73001.1"
FT                   /translation="MNVITSFKKKKQEKQMLYERKMLRELSLERLKTQAIEHFSPLYRI
FT                   YRAFSSVIEEGCIDIAIEAYLLGANYSRFGYYGEPAEFVKRRCAQEEKYLIDALFDFLC
FT                   FWGNIGDGLADESLYLACEHYIAYWWMEGFEKGKKRRRLKLH"
     MNVITSFKKK KQEKQMLYER KMLRELSLER LKTQAIEHFS PLYRIYRAFS SVIEEGCIDI        60
     AIEAYLLGAN YSRFGYYGEP AEFVKRRCAQ EEKYLIDALF DFLCFWGNIG DGLADESLYL       120
     ACEHYIAYWW MEGFEKGKKR RRLKLH                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page