(data stored in ACNUC7421 zone)

EMBL: CP002293.PE146

CP002293.PE146       Location/Qualifiers
FT   CDS             154404..155111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0146"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /note="TIGRFAM: N-acetylmuramoyl-L-alanine amidase CwlD;
FT                   PFAM: cell wall hydrolase/autolysin; KEGG: gwc:GWCH70_0147
FT                   N-acetylmuramoyl-L-alanine amidase CwlD; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73002"
FT                   /db_xref="GOA:A0A0F6BHV1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV1"
FT                   /inference="protein motif:TFAM:TIGR02883"
FT                   /protein_id="ADP73002.1"
FT                   /translation="MKTKWLAALMSSIIVIVLFQYIFANTTSTKSWNLPLSGRIIVLDP
FT                   GHGGPDGGAVGGDVVEEEVALKVAEKLRDYLQQQGALVLMTREMDSDLADKDTRGYRRR
FT                   KVEDLRKRVALINESEADLFISIHLNAIPSPRWRGAQTFYYGSLLENERLAKFIQAELR
FT                   RNLENTDRVAKRIDTVYLLKYAKKPGALVEVGFLSHPEERELLASDRYQTKLAAAVYKG
FT                   VLRYFSNEKNPPE"
     MKTKWLAALM SSIIVIVLFQ YIFANTTSTK SWNLPLSGRI IVLDPGHGGP DGGAVGGDVV        60
     EEEVALKVAE KLRDYLQQQG ALVLMTREMD SDLADKDTRG YRRRKVEDLR KRVALINESE       120
     ADLFISIHLN AIPSPRWRGA QTFYYGSLLE NERLAKFIQA ELRRNLENTD RVAKRIDTVY       180
     LLKYAKKPGA LVEVGFLSHP EERELLASDR YQTKLAAAVY KGVLRYFSNE KNPPE            235
//

If you have problems or comments...

PBIL Back to PBIL home page