(data stored in ACNUC7421 zone)

EMBL: CP002293.PE152

CP002293.PE152       Location/Qualifiers
FT   CDS             165552..166472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0152"
FT                   /product="arginase"
FT                   /note="KEGG: gwc:GWCH70_0153 arginase; TIGRFAM: arginase;
FT                   PFAM: Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73008"
FT                   /db_xref="GOA:A0A0F6BHV7"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV7"
FT                   /inference="protein motif:TFAM:TIGR01229"
FT                   /protein_id="ADP73008.1"
FT                   /translation="MERGNSVKKVSIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERL
FT                   HYEIEDLGDVSIGKMEWSDDEGLRLNLRNLKAVAKTNEKLAEMVDDVVQRGRFPLVLGG
FT                   DHSIAIGTLAGVAKHYQNLGVIWYDAHGDLNTAETSPSGNIHGMSLAVCLGLGHPYLTK
FT                   IGGYSPKVKPENVVLIGVRSLDEGEKQLIREKGIKVYTMHEVDRLGMAAVMEETIAYLQ
FT                   GRTDGVHLSLDLDGLDPHDAPGVGTPVIGGLTYRESHLAMEMLAEAQLITSAEFVEVNP
FT                   ILDERNKTASVAVGLMGSLFGEKLV"
     MERGNSVKKV SIIGVPMDLG QTRRGVDMGP SAMRYAGIIE RLERLHYEIE DLGDVSIGKM        60
     EWSDDEGLRL NLRNLKAVAK TNEKLAEMVD DVVQRGRFPL VLGGDHSIAI GTLAGVAKHY       120
     QNLGVIWYDA HGDLNTAETS PSGNIHGMSL AVCLGLGHPY LTKIGGYSPK VKPENVVLIG       180
     VRSLDEGEKQ LIREKGIKVY TMHEVDRLGM AAVMEETIAY LQGRTDGVHL SLDLDGLDPH       240
     DAPGVGTPVI GGLTYRESHL AMEMLAEAQL ITSAEFVEVN PILDERNKTA SVAVGLMGSL       300
     FGEKLV                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page