(data stored in ACNUC7421 zone)

EMBL: CP002293.PE153

CP002293.PE153       Location/Qualifiers
FT   CDS             166631..167194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0153"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: gwc:GWCH70_0154 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-W
FT                   factor; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73009"
FT                   /db_xref="GOA:A0A0F6BHV8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV8"
FT                   /inference="protein motif:TFAM:TIGR02948"
FT                   /protein_id="ADP73009.1"
FT                   /translation="MEIFVKKRIKAIKKGDQNAYADIVDLYKDKIYRLCYRMLGNRHEA
FT                   EDTAQEAFIRAYVNIHTYNPNMKFSSWLYRIATNLAIDKIRKKKPDAYLDEEISGTDGL
FT                   TMYSQLSSSEASPEETLESLELQETVQKAIEKLPEKYRSVIVLRYIEDLSLQEISEILD
FT                   LPLGTVKTRIHRGREALRKHLGHL"
     MEIFVKKRIK AIKKGDQNAY ADIVDLYKDK IYRLCYRMLG NRHEAEDTAQ EAFIRAYVNI        60
     HTYNPNMKFS SWLYRIATNL AIDKIRKKKP DAYLDEEISG TDGLTMYSQL SSSEASPEET       120
     LESLELQETV QKAIEKLPEK YRSVIVLRYI EDLSLQEISE ILDLPLGTVK TRIHRGREAL       180
     RKHLGHL                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page