(data stored in SCRATCH zone)

EMBL: CP002293.PE154

CP002293.PE154       Location/Qualifiers
FT   CDS             167209..167820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0154"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: gwc:GWCH70_0155 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73010"
FT                   /db_xref="GOA:A0A0F6BHV9"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV9"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0155"
FT                   /protein_id="ADP73010.1"
FT                   /translation="MKCPHNIVNLMHDYLDGDIEPNDAKILREHLQQCSACADHFNGLK
FT                   KTVAFIQHASHLIPPADFTARVMAKLPKEKKMIRMRRWLQNHPFITAASLFVILTIGSL
FT                   FTTWNEQRQFSVSAHENVIIRGHTVIVPKGEVVKGDIVVRNGSIKIEGKVEGNVTVIHG
FT                   EKYLASAGQVTGELEEINQVFEWIWYNIKERVKDVMEVFE"
     MKCPHNIVNL MHDYLDGDIE PNDAKILREH LQQCSACADH FNGLKKTVAF IQHASHLIPP        60
     ADFTARVMAK LPKEKKMIRM RRWLQNHPFI TAASLFVILT IGSLFTTWNE QRQFSVSAHE       120
     NVIIRGHTVI VPKGEVVKGD IVVRNGSIKI EGKVEGNVTV IHGEKYLASA GQVTGELEEI       180
     NQVFEWIWYN IKERVKDVME VFE                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page