(data stored in ACNUC7421 zone)

EMBL: CP002293.PE157

CP002293.PE157       Location/Qualifiers
FT   CDS             170002..171348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0157"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: gwc:GWCH70_0158 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73013"
FT                   /db_xref="GOA:A0A0F6BHW2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW2"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADP73013.1"
FT                   /translation="MGKYFGTDGVRGVANRELTPELAFKIGRCGGYVLTKSEKRPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPV
FT                   QDNGIKFFGPDGFKLSDEQEQEIEALIDSPEDMLPRPIGEALGQVNDYFEGGQKYLQYL
FT                   KQTIDEDFSGIKIALDCAHGATSSLATHLFADLEADVVTMGASPNGININEGVGSTHPE
FT                   ALAAFVKEKGADVGLAFDGDGDRLIAVDEYGNIVDGDQIMYICAKYLKEIGRLKQQTVV
FT                   STVMSNLGFYKALEAQGIQSVQTAVGDRYVVEEMRKNGYNLGGEQSGHIIFLDYNTTGD
FT                   GLLTALQLVNIMKIKEKPLSELASEVKKYPQLLVNVKVADKHKVMENEKVKAVIQEVEK
FT                   EMSENGRVLVRPSGTEPLVRVMVEAPTEETCRNYVERIASVIREEMGTE"
     MGKYFGTDGV RGVANRELTP ELAFKIGRCG GYVLTKSEKR PKVLIGRDTR ISGHMLEGAL        60
     VAGLLSIGAE VMRLGVISTP GVAYLTKALG AQAGIMISAS HNPVQDNGIK FFGPDGFKLS       120
     DEQEQEIEAL IDSPEDMLPR PIGEALGQVN DYFEGGQKYL QYLKQTIDED FSGIKIALDC       180
     AHGATSSLAT HLFADLEADV VTMGASPNGI NINEGVGSTH PEALAAFVKE KGADVGLAFD       240
     GDGDRLIAVD EYGNIVDGDQ IMYICAKYLK EIGRLKQQTV VSTVMSNLGF YKALEAQGIQ       300
     SVQTAVGDRY VVEEMRKNGY NLGGEQSGHI IFLDYNTTGD GLLTALQLVN IMKIKEKPLS       360
     ELASEVKKYP QLLVNVKVAD KHKVMENEKV KAVIQEVEKE MSENGRVLVR PSGTEPLVRV       420
     MVEAPTEETC RNYVERIASV IREEMGTE                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page