(data stored in ACNUC7421 zone)

EMBL: CP002293.PE16

CP002293.PE16        Location/Qualifiers
FT   CDS             complement(24941..26227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0016"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="KEGG: gwc:GWCH70_0017 glycoside hydrolase family 18;
FT                   PFAM: glycoside hydrolase family 18; Peptidoglycan-binding
FT                   lysin domain; SMART: chitinase II; Peptidoglycan-binding
FT                   LysM"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72872"
FT                   /db_xref="GOA:A0A0F6BHH1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH1"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /protein_id="ADP72872.1"
FT                   /translation="MQIHVVQRGQTLSGIAQAYNTTPEEIIQANDLPNPDNLVVGQAIV
FT                   IPIVGRFYWVLRGDSLWSISRRFSIPMQQLAQINRISLDSPLQVGQRLYIPPRTKRRAE
FT                   FNGYIEPRGTAVSPALEASARQAAPHLTYLAPFHFQIQRNATLKEPPLNNFPSIARANG
FT                   VTLMMVVTNIENEQFSDELGALILNNEQLQNRLLDNITTIAKKYGFHDIHFDMEYLRPE
FT                   DREAYNAFLRKAKQRFGREGWLLSTALAPKTSATQKGRWYEAHDYRAHGQIADFVIIMT
FT                   YEWGYSGGPPMAVSPIGPVRRVLEYAISEIPASKIMMGQNLYGYDWTLPYVPGGPYAQA
FT                   ISPQQALRLASQHNVTIEYDANAQAPHFRYRDESGKEHEVWFEDARSIQAKFNLVKELG
FT                   LRGMSYWKLGLDFPQNWLLLTDNFTVVKK"
     MQIHVVQRGQ TLSGIAQAYN TTPEEIIQAN DLPNPDNLVV GQAIVIPIVG RFYWVLRGDS        60
     LWSISRRFSI PMQQLAQINR ISLDSPLQVG QRLYIPPRTK RRAEFNGYIE PRGTAVSPAL       120
     EASARQAAPH LTYLAPFHFQ IQRNATLKEP PLNNFPSIAR ANGVTLMMVV TNIENEQFSD       180
     ELGALILNNE QLQNRLLDNI TTIAKKYGFH DIHFDMEYLR PEDREAYNAF LRKAKQRFGR       240
     EGWLLSTALA PKTSATQKGR WYEAHDYRAH GQIADFVIIM TYEWGYSGGP PMAVSPIGPV       300
     RRVLEYAISE IPASKIMMGQ NLYGYDWTLP YVPGGPYAQA ISPQQALRLA SQHNVTIEYD       360
     ANAQAPHFRY RDESGKEHEV WFEDARSIQA KFNLVKELGL RGMSYWKLGL DFPQNWLLLT       420
     DNFTVVKK                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page