(data stored in ACNUC7421 zone)

EMBL: CP002293.PE161

CP002293.PE161       Location/Qualifiers
FT   CDS             177689..178567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptm:GSPATT00027155001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW6"
FT                   /inference="similar to AA sequence:KEGG:GSPATT00027155001"
FT                   /protein_id="ADP73017.1"
FT                   /translation="MHSSVSFNYHTLHFKNVQHIPLNPTAPLVKIKNASSITLDKLTLS
FT                   NVIGNVTTSNQKIKVTEVKGEEQQNSDYEQYFSSFFENLEGVSEEEKNQLSELVKAALK
FT                   YNEDYFSSWTSDKASMYYLQTQEKLNLIADNVAGGSIKEQLKAITKQYTNDKLKQIVNT
FT                   SLETYQIIYDRFKGKGGPYSEIAKQMKNAIEEIQNGNHADQISQQQLSQLFSDLNTNSS
FT                   FQIGYEKIMRGYKEIQKRQLGKYWNTFSEADVDKTINMLREDWNNFVSQFQMFEPYRVS
FT                   IGSQSRIDMKI"
     MHSSVSFNYH TLHFKNVQHI PLNPTAPLVK IKNASSITLD KLTLSNVIGN VTTSNQKIKV        60
     TEVKGEEQQN SDYEQYFSSF FENLEGVSEE EKNQLSELVK AALKYNEDYF SSWTSDKASM       120
     YYLQTQEKLN LIADNVAGGS IKEQLKAITK QYTNDKLKQI VNTSLETYQI IYDRFKGKGG       180
     PYSEIAKQMK NAIEEIQNGN HADQISQQQL SQLFSDLNTN SSFQIGYEKI MRGYKEIQKR       240
     QLGKYWNTFS EADVDKTINM LREDWNNFVS QFQMFEPYRV SIGSQSRIDM KI               292
//

If you have problems or comments...

PBIL Back to PBIL home page