(data stored in ACNUC7421 zone)

EMBL: CP002293.PE162

CP002293.PE162       Location/Qualifiers
FT   CDS             179748..180401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0165"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: bat:BAS4107 HAD superfamily hydrolase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73018"
FT                   /db_xref="GOA:A0A0F6BHW7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW7"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADP73018.1"
FT                   /translation="MIKAIIFDFDGLIVDTETAWFEAYKETMSLYKVDLPLERFVECVG
FT                   SDNTALYEFFKQQLGESCDIAEIEAKAKSLYKIKMKTPQAREGVKDYLEEAKKWGYKIA
FT                   IASSSTKEWVTHYLKELGLLHYFEVMITQDDVDKVKPAPDLYLKAVDALNISPNEALAF
FT                   EDSLNGLQAALAAGLKCVIVPNPVTESLPFENYDLRLTSMTEKRFIDVIKQIEQ"
     MIKAIIFDFD GLIVDTETAW FEAYKETMSL YKVDLPLERF VECVGSDNTA LYEFFKQQLG        60
     ESCDIAEIEA KAKSLYKIKM KTPQAREGVK DYLEEAKKWG YKIAIASSST KEWVTHYLKE       120
     LGLLHYFEVM ITQDDVDKVK PAPDLYLKAV DALNISPNEA LAFEDSLNGL QAALAAGLKC       180
     VIVPNPVTES LPFENYDLRL TSMTEKRFID VIKQIEQ                                217
//

If you have problems or comments...

PBIL Back to PBIL home page